Human Metalloproteinase Inhibitor 1 (TIMP1)
Human Metalloproteinase Inhibitor 1 (TIMP1)

Human Metalloproteinase Inhibitor 1 (TIMP1)

Catalog NumberKL-MA-00020

CategoryMetabolism

Purity 85±5% by SDS-PAGE
Appearance Liquid
Application Calibrator or standard
Shelf Life -20°C for 18 months
Storage Aliquot and store at ≤-20°C. Avoid repeated freeze/thaw cycles
Buffer Dissolved in 20mM Tris-HCl, 500mM NaCl, pH 8.0, 50% glycerol
Expression Region 24-207aa
Sequence CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Source Yeast
Tags His-tag

Please kindly note that our products and services are for research use only.

Verification code