Anti-h Inhibin Beta A
Anti-h Inhibin Beta A

Anti-h Inhibin Beta A

Catalog NumberKL-HO-00020

CategoryHormones

Description Monoclonal mouse antibody, cultured in vitro under conditions free from animal-derived components
Purity ≥95%
Appearance Liquid, may turn slightly opaque during stroage
Application FIA
Shelf Life 36 months
Storage 2-8°C
Buffer 50mM Na-citrate, pH 6.0, 0.9% NaCI, 0.095% NaN3 as a preservative
Clonality Monoclonal
Concentration 5.0 mg/ml (+/- 10 %)
Epitope Amino acids 81-112 (CVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEE)
Host Human
Isoelectric Point 7.1-8.5
Isotype IgG1
Shipping Cold Packs
Specificity Antibody recognizes human inhibin beta A subunit, also known as activin beta A

Please kindly note that our products and services are for research use only.

Verification code